PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5AL_0DF34352F.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family FAR1
Protein Properties Length: 840aa    MW: 95699.8 Da    PI: 6.9481
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5AL_0DF34352F.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR180.92.2e-2588176289
                   FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkk.tekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHe 88 
                            fY +YA +vGFsvr+++s+ksk +++i++ +fvCskeg+++e++    +k+r++ a+ r gC+a+l+v ++ d+kw+ tkl++eHnHe
  Traes_5AL_0DF34352F.2  88 FYIAYAGRVGFSVRIARSRKSKCSESIIMLRFVCSKEGFSKEKRVVeGKKTRKRLASIREGCNAMLEVLRRGDNKWVATKLVKEHNHE 175
                            9**************************************999876635677778899******************************9 PP

                   FAR1  89 l 89 
                            +
  Traes_5AL_0DF34352F.2 176 V 176
                            6 PP

2FAR163.75.2e-20210296291
                   FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHel 89 
                            fY +YA ++GF+vr+++s+ks ++++ ++ ++vCs++ +++ ++++     ++r  +r gC+a +++ ++++g+w+v+kl leH+Hel
  Traes_5AL_0DF34352F.2 210 FYYSYAIRAGFEVRVRQSRKS-QDESLKMLKLVCSRHRYHSGRENN--GDDTKRDPSRDGCNALFEIIRKDKGVWRVSKLILEHSHEL 294
                            9*******************9.6777***************99988..88899999*******************************9 PP

                   FAR1  90 ap 91 
                            +p
  Traes_5AL_0DF34352F.2 295 NP 296
                            75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031013.2E-2388176IPR004330FAR1 DNA binding domain
PfamPF031012.0E-17210296IPR004330FAR1 DNA binding domain
PfamPF105513.7E-19397487IPR018289MULE transposase domain
PROSITE profilePS509669.569664712IPR007527Zinc finger, SWIM-type
PfamPF044344.0E-5672709IPR007527Zinc finger, SWIM-type
SMARTSM005751.3E-5687714IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 840 aa     Download sequence    Send to blast
MMEPQGVELE DDSIDFWASL GVSTHVHGVD QMALHSVHIL DHQGQSLPPA VVSHPESVCK  60
ELFPVEADPC LEPRVGMEFE SGEAAKTFYI AYAGRVGFSV RIARSRKSKC SESIIMLRFV  120
CSKEGFSKEK RVVEGKKTRK RLASIREGCN AMLEVLRRGD NKWVATKLVK EHNHEVGMPS  180
TVHYIATESD TMVDPYIDME FESLESAKTF YYSYAIRAGF EVRVRQSRKS QDESLKMLKL  240
VCSRHRYHSG RENNGDDTKR DPSRDGCNAL FEIIRKDKGV WRVSKLILEH SHELNPAPAS  300
SVCCVRSQGE VLVIAKNFAD TRNLLLNGQD SQPHREIRYN DLGPEDAQSL LEYLKKVQAE  360
DPAFFYAVQL DKHEDTVNIF WADASARMAY YHFGDAVRFE TAYRSNKEHI PIVIFSGVNH  420
HVQPVIFGCA LLVDESEESF VWLFEKWLEA MHVRPPVSFV TELNQEMAAA AAKVLPDTCH  480
IFCEKHILGT VKEELHSIYP GLDHFITDLR KCIDGCRIEE SFESCWESVL IKHGFRNNEH  540
LQSLYDIRER WAPAYTKQSF HARNLLAQSC QNLEKIIDTY FSSKTQLVVA VQQLEQAICN  600
FHAKEAQVDY LTMFQPPALR TASPVEKQAG LVFSRKVFDI FQEQFAESFG YHAERLEDRM  660
LHKYRLTVDD GDEEAHIVSF SPDQSTVCCS CCLFESCGIL CRHALRVFII EGVRFLPKAY  720
VLKRWTKHAK STVTLDNYIE LRGYCEDPST SRYNDLCYDA NKCAKEGSTS TERYKIAKEA  780
LCKALDEIMP TRNIREQNSQ NCTTSLRSPV KKLGTSKGTS GKSIKRPAFK NSLVESNGSR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2527740.0AK252774.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf172k23, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014756691.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X3
TrEMBLW5EUL90.0W5EUL9_WHEAT; Uncharacterized protein
STRINGMLOC_56869.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1832967
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-120FAR1-related sequence 5
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]